synonym | turning |
hypernym | change of course |
hyponym | deflectiondeflexiondeviationdigressiondivagationdiversionkick turnleftrightstemstem turnswerveswervingtelemarkthree-point turnveeringversion |
hypernym | change of directionreorientation |
hypernym | walk |
synonym | twist |
hypernym | rotary motionrotation |
hyponym | twiddle |
synonym | actbitnumberroutine |
hypernym | performancepublic presentation |
hyponym | show-stoppershowstopperstopper |
synonym | turning |
hypernym | motionmovement |
hyponym | coming backgyrationreturnreversalrevolutionrotationswerveturn aroundvolutionyaw |
synonym | turn of eventstwist |
hypernym | development |
synonym | boutround |
domain topic | athleticssport |
holo part | period of playplayplaying period |
hypernym | divisionpartsection |
hyponym | bottombottom of the inningtoptop of the inning |
synonym | gospelltour |
hypernym | duty periodshiftwork shift |
synonym | release |
hypernym | channelchannelisechannelizetransfertransmittransport |
hyponym | deflatethrow |
synonym | move around |
hypernym | golocomotemovetravel |
hypernym | displacemove |
hyponym | bring about |
similar | turn |
domain topic | commercecommercialismmercantilism |
hypernym | acquireget |