WordRel.com

• an impressionistic portrayal of a person

  derivation	impressionisticimpressionistic
  hypernym	characterizationenactmentpersonationportrayal

• the act of pressing one thing on or into the surface of another

  derivation	impress
  hypernym	presspressingpressure

• (dentistry) an imprint of the teeth and gums in wax or plaster

  domain topic	dental medicinedentistryodontology
  hypernym	imprint

• an outward appearance

  synonym	effect
  derivation	impressionistic
  hypernym	appearancevisual aspect
  hyponym	figureimagemarktout ensemble

• a vague idea in which some confidence is placed

  synonym	belieffeelingnotionopinion
  derivation	impressionistic
  hypernym	ideathought
  hyponym	effectfirst blushhunchintuitionpresencesuspicion

• a clear and telling mental image

  synonym	mental picturepicture
  hypernym	imagemental image

• a symbol that is the result of printing or engraving

  synonym	stamp
  hypernym	symbol
  hyponym	embossmentimprintseal

• all the copies of a work printed at one time

  synonym	printing
  domain topic	printingprinting process
  hypernym	publication
  hyponym	editionmackleprooftest copytrial impression

• a concavity in a surface produced by pressing

  synonym	depressionimprint
  hypernym	concave shapeconcavityincurvationincurvature
  hyponym	channelchapcrackcrannycreasecrevicecrinkledentdimpledimpledipdroopfissurefurrowgrooveincisionlinepricksagscratchseamslitwrinkle